Anti-RT1-T18 (rat) antibodies | |
Protein name(s) | Protein RT1-T18; RT1 class I, T18; |
Gene name(s) | RT1-T18; 2458a2 2461a1a2 2463a1a2 2464a1 2509a1 2539a1a2 2543a1 2600a1a2 2609a1a2 2619a1 2626a1a2 2641a1 2646a1a2 2661a1a2 2664a1 2669a1 2673a1a2 2683a1 2690a1-a1a2 2702a1 2705a1 2715a1 2722a1a2 2738a1a2 2743a1 2747a1a2 2759a1 2764a1 2768a1a2 H2-T18 Nerg-癷?癸 |
Cross ref(s) | NP_001002821.1; |
Length | 349 AA |
AbClass™ | Easy (learn more) |
Sequence | MGNMVPSALLLLLATSPGETQTCSGSHSLRYFYTALSRPAPGESWYIAVGYVDDTQFVRFNSAGESARYKLRASWVEQEGPEYWQKETEIVTSNAQFFRGNLQTMLDYYNLSHDGSHIIQVMYGCDVESDGSLLRGYEQYAYDGRDYITLNEDLKTWTAEDRAAQITRLKWEQAGYAELRRTYLEGPCKDSLLRYLENRKEMLQCTDPPKAHVSHHPGHEGDVTLRCWALGFYPADITLIWKKEEEELNQEMELI癷?癸 |
Antibodies available |
Each product listed below is a combination of individual monoclonal antibodies (mAbs) against a panel of synthetic peptide antigens from the corresponding region of the target protein. Each combination of mAbs is recommended to be used directly. Later, they can be deconvoluted (if necessary) as individual monoclonal antibodies after epitope determination for each single mAb. Epitope determination service is available at $100 per combination. |
X-Q6MFZ7 -N | |
Description | A combination of mouse monoclonal antibodies against Q6MFZ7 N terminus sequence |
Antigen information | 3 synthetic peptides representing the N terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
X-Q6MFZ7 -C | |
Description | A combination of mouse monoclonal antibodies against Q6MFZ7 C terminus sequence |
Antigen information | 3 synthetic peptides representing the C terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
X-Q6MFZ7 -M | |
Description | A combination of mouse monoclonal antibodies against Q6MFZ7 M terminus sequence |
Antigen information | 3 synthetic peptides representing the non-terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
Purchase Options for Total Protein Detection |
Choose a recommended package covered by AbInsure™ program. | |||||
End-use | Recommended package | Price | Description | Availability | |
WB ![]() |
X1 -Q6MFZ7 | $ 599 | AbInsure™ | Delivered in 30 days | |
1 antibody combination included | |||||
X-Q6MFZ7 - N |
Or choose a single combination (NOT covered by AbInsure™ program) | ||
Antibodies available | Price | Availability |
X-Q6MFZ7 -N | $599 | Delivered in 30 days |
X-Q6MFZ7 -C | $599 | Delivered in 30 days |
X-Q6MFZ7 -M | $599 | Delivered in 30 days |
Or freely design a custom antibody development project (NOT covered by AbInsure™ program). |
We design and produce custom monoclonal antibodies tailored for your specific needs. If you cannot find antibodies you need from the above list, please don't hesitate to contact us for a free consultation. - Functional (blocking or neutrualizing) - Family cross-reactive or family distinguishing - Specific epitope(s) - Other special needs |
Any protein in rat
From $599
5 – 30 days to deliver
Find yours by protein name,
gene symbol or accession number